Lactoferrin — an endogenous regulator of the protective functions of the organism

Cover Page

Abstract


Lactoferrin — multifunctional glycoprotein of the transferrin family with a molecular mass of about 80 kDa. The review presents data on the physicochemical properties and localization of the protein, on antimicrobial properties, antitumor and anti-inflammatory effects, participation in neuroendocrinoimmune interactions, and on possible mechanisms for the realization of its functional manifestations.


Само название белка «лактоферрин» говорит о том, что он содержится в молоке и имеет в своем составе железо. Впервые лактоферрин был обнаружен в коровьем молоке в 1939 г. [1] и обратил на себя внимание благодаря своему красному цвету. В 1960 г. он был выделен из молока человека и коровы [2, 3]. В молоке человека лактоферрин (ЛФ) является одним из основных белков молока неказеиновой природы, его содержание составляет около 2 мг/мл [4]. К настоящему времени ЛФ выделен из молока человека, коровы, морской свинки [5], овцы [6], козы [7], свиньи [8], кобылы [9], мыши [10] и собаки [11].

В 1963 г. ЛФ был впервые обнаружен в бронхиальном секрете человека [12], а к 1966 г. его выявили почти во всех внешних секретах человека: в слезах, слюне, носовых и бронхиальных смывах, желудочно-кишечном соке, желчи, моче, семенной жидкости, слизи шейки матки [13]. Стоит отметить, что в молоке мыши, морской свинки, коровы, козы присутствует также трансферрин в количестве, эквивалентном ЛФ, а в молоке крысы и кролика основным железосвязывающим белком является трансферрин [4].

В 1969 г. ЛФ впервые был идентифицирован как один из главных белков, присутствующих в нейтрофильных гранулоцитах (НГ) человека и морской свинки [14]. В более поздних работах было установлено, что ЛФ локализован в специфических гранулах и не содержится в азурофильных [15, 16].

Молекулярные массы ЛФ из различных источников очень близки и составляют 80–84 кДа.

Показано, что ЛФ представляют собой гликопротеины, состоящие из одной полипептидной цепи, третичная структура которых образует две доли (N и С), каждая из них содержит сайт для связывания железа, расположенный между доменами N1 и N2 и С1 и С2 соответственно [17–19] (рис. 1).

 

Рис. 1. Ленточная диаграмма лактоферрина человека. В N-доле (слева) связанные ионы Fe3+ и CO32– (показаны в виде сферических атомов, указаны стрелками) расположены между двумя доменами, N1 и N2. Аналогично для C-доли (справа) домены C1 и C2, между ними находятся ионы Fe3+и CO32–. Две доли соединены трехвитковыми спиралями [19]

Fig. 1. Ribbon diagram of human lactoferrin. The N-lobe is on the left, with its bound Fe3+ and CO32– ions (shown as spherical atoms, indicated by arrows) in the cleft between the two domains, N1 and N2. Similarly, for the C-lobe (right) the C1 and C2 domains with the Fe3+ and CO32– ions in between. The two lobes are joined by a three-turn helix [19]

 

Лактоферрин считается наиболее поливалентным белком, обнаруженным у позвоночных. В течение более чем 40 лет исследований для ЛФ было выявлено множество функциональных характеристик.

Первоначальные исследования функций ЛФ были обусловлены тем, что он очень напоминал трансферрин, железосвязывающий белок, ключевая роль которого по обеспечению железом развивающихся эритроцитов уже была известна. Таким образом, ранние исследования ЛФ были сосредоточены на изучении функций, аналогичных функциям трансферрина, то есть как белка — переносчика железа в кишечнике, участвующего в поглощении железа, и как регулятора роста микробов в тканях слизистой оболочки через лишение железа.

При связывании ионов железа (Fe3+) образуется комплекс красного цвета с максимумом поглощения в видимой области при l = 460–470 нм. Лактоферрин связывает также ионы других металлов переменной валентности, в частности, его комплекс с ионами меди (Cu2+) имеет максимум поглощения при 430–440 нм (белок желтого цвета) [5], а комплексы ЛФ с ионами хрома, марганца и кобальта окрашены в серо-зеленый, коричневый и желтый цвета соответственно [20].

Благодаря своей способности связывать железо и медь ЛФ, по-видимому, может играть определенную роль в их метаболизме. Как металлы переменной валентности, железо и медь могут легко окисляться и восстанавливаться, образовывать сложные соединения, непосредственно участвовать в реакциях электронного транспорта. В то же время эта высокая реактивность обусловливает значительную токсичность свободных металлов. В процессе эволюции организмы приобрели специальные белки, которые принимают участие в транспорте и хранении железа и меди. Основным белком, с помощью которого осуществляется хранение железа у большинства организмов, является ферритин. Главным транспортным белком для железа служит трансферрин, а для меди — церулоплазмин. В плазме крови их концентрации составляют около 2,5 мг/мл и 500 мкг/мл соответственно. Лактоферрин содержится в плазме крови в очень малом количестве (около 1 мкг/мл), источником его, по всей вероятности, являются нейтрофилы [21], и он не может конкурировать с трансферрином и церулоплазмином в транспорте металлов.

Однако хелатирующая способность ЛФ несомненно имеет большое значение. Еще в 1968 г. было установлено, что ЛФ оказывает антибиотическое действие, которое обусловлено комплексообразующей способностью этого белка. Железо представляет собой исключительно важный элемент для развития не только макроорганизма, но и микроорганизмов. С этой точки зрения соединения, способные связывать железо из окружающей среды, должны обладать бактериостатическим свойством. Такое свойство и присуще ненасыщенному железом ЛФ [7]. Известно, что в молоке ЛФ насыщен железом не более чем на 20 % [5], поэтому некоторые авторы полагают, что ЛФ принимает участие в регуляции состава микробиоты у новорожденных, защищая макроорганизм от энтеропатогенных микроорганизмов [22].

Антибактериальная активность может реализовываться как через способность ЛФ связывать железо [23, 24], так и независимо от железосвязывающей активности. Лактоферрин оказывает и прямое бактерицидное действие на некоторые микроорганизмы (Streptococcus mutans, S. salivarius, S. mutior, S. pneumoniae ATCC 6303, Vibrio cholerae 5698, Pseudomonas aeruginosa и др.), и, хотя это действие наблюдается только у ненасыщенного белка, механизм его, видимо, более сложен, чем простое обеднение железом окружающей среды, и зависит от вида бактерий. Необходим прямой контакт ЛФ с микробом, показано, что связывание N-концевой области ЛФ с бактериальной стенкой приводит к нарушению целостности мембран бактерий и низших грибов [25, 26].

Необходимо отметить, что бактерицидный эффект отмечается при довольно высоких концентрациях ЛФ — от 1,2 до 50 мкМ (100 мкг/мл — 4 мг/мл). В молоке некоторых видов млекопитающих содержания ЛФ достаточно для проявления антимикробного действия. Если же рассматривать возможность такого действия ЛФ в НГ в процессе фагоцитоза, то в силу малого свободного объема фаголизосомы концентрация ЛФ в ней может быть даже выше требуемой. Известно также, что в НГ ЛФ содержится преимущественно в ненасыщенном железом состоянии [27].

В настоящее время показано, что ЛФ продуцируется эпителиальными клетками и содержится в большинстве экзокринных секретов [5, 28], таких как семенная жидкость, экзокринные выделения поджелудочной железы, слезы, слюна, выделения матки, и в молоке, где его концентрация у людей может варьировать от 1 до 6 г/л (молозиво) [29].

Лактоферрин присутствует на всех слизистых оболочках и эпителии, где благодаря своему противомикробному действию вместе с секретируемым IgA и дефенсинами может влиять на микробный гомеостаз [30]. Кроме этого при активации НГ, которая начинается с первых шагов адгезии к активированному эндотелию, ЛФ поступает в кровь, где его концентрация может повышаться до 200 мг/л (от примерно 1 мг/л в нормальных условиях), особенно в воспаленных тканях [31–34]. Кроме того, микроглиальные клетки, которые действуют как резидентные макрофаги в головном мозге, также синтезируют ЛФ при воспалении [35].

Такая топография позволяет говорить о возможной роли ЛФ в противоинфекционном иммунитете. Соответственно, подавляющее число исследований посвящено изучению роли ЛФ как молекулярного фактора врожденного иммунитета.

Показано, что он проявляет антибактериальную, противогрибковую, противовирусную, противопаразитарную, противовоспалительную и иммуномодулирующую активность [36–38].

Бактерицидные свойства характерны и для коротких N-концевых фрагментов ЛФ, образующихся путем ограниченного протеолиза. В процессе кислотного гидролиза ЛФ крупного рогатого скота формируется пептид, представляющий собой фрагмент N-концевой части молекулы из ее первых 54 аминокислотных остатков, — лактоферрицин А: 1APRKNVRWCTISQPEWFKCRRWQWRMKKLGAPSITCVRRAFALECIRAI-AEKKA54 [39], а при обработке пепсином более короткий участок — лактоферрицин В [25]: 17FKCRRWQWRMKKLGAPSITCVRRAF41 [40]. Образующиеся пептиды обладают гораздо более широким спектром микробоцидного действия при меньшей концентрации [41]. В ходе протеолиза ЛФ человека образуется пептид — лактоферрицин Н, обладающий свойствами, аналогичными пептиду из ЛФ крупного рогатого скота [42]. Установлено наличие дисульфидной связи в лактоферрицине В [43], а в его функциональном гомологе из ЛФ молока человека — лактоферрицине Н (1GRRRRSVQWCAVSQPEATKCFQWQRNMRKVRGPPVSC-IKRDSPIQCI47) — два S-S-мостика [44].

Интересно, что идентичный лактоферрицину В пептид выделили из содержимого желудка человека уже через 10 минут после перорального приема ЛФ крупного рогатого скота [45]. Аналогичный результат был получен в экспериментах на крысах [46].

Механизм антимикробного действия лактоферрицинов, по-видимому, сходен с механизмом действия дефенсинов, протегринов, бактеницина и других антимикробных пептидов животного происхождения. Показан также механизм антимикробного действия ЛФ через ингибирование микробной H+-АТФазы [47].

Независимо от способности связывать железо ЛФ ингибирует бактериальную и вирусную адгезию к клеткам-хозяевам через его конкурентное связывание с клетками-хозяевами и/или с компонентами вирусных частиц или мембран микроорганизмов [36, 48].

Действие ЛФ против вируса лейкемии Френда (FVC), вызывающего эритролейкемию у мышей, обусловлено, по-видимому, способностью ЛФ влиять на процесс миелопоэза в костном мозге, так как вирулентность FVC жестко привязана к фазе синтеза ДНК клеточного цикла клеток-мишеней [49, 50].

Следует отметить, что ЛФ проявляет противоопухолевую активность не только против опухолей, вызываемых инфекционным агентом. Он ингибирует рост твердых (солидных) опухолей и развитие экспериментальных метастазов у мышей [51]. В основе противоопухолевого действия ЛФ лежат, скорее всего, иммуномодулирующие свойства ЛФ [52]. Другим возможным механизмом положительного действия ЛФ может быть способность лактоферрицина вызывать апоптоз опухолевых клеток через активацию киназ JNK/SAPK [53]. Противоопухолевое действие ЛФ может быть также опосредовано способностью этого белка активировать естественные киллерные клетки [54] и повышать цитотоксическую активность макрофагов и нейтрофилов [55]. Пероральное введение ЛФ животным с опухолями увеличивает количество CD4+- и CD8+-лимфоцитов в крови и продукцию ИЛ-18, интерферона-γ и каспазы-1 в слизистой тонкой кишки [56].

Еще одним важным качеством ЛФ как противоопухолевого препарата является его способность снижать иммуносупрессивное действие цитостатиков и антиметаболитов, таких как циклофосфамид и метотрексат, используемых в традиционной противоопухолевой терапии [57].

Если говорить о противовоспалительном действии ЛФ, то здесь могут быть задействованы различные механизмы. Один из возможных механизмов обусловлен свойством ЛФ связывать железо в сайтах воспаления и тем самым снижать интенсивность реакции Габера – Вайса (в результате которой образуются свободные радикалы), способствуя уменьшению окислительного стресса [58].

Другой из наиболее часто рассматриваемых механизмов осуществляется за счет способности ЛФ связывать липополисахариды (ЛПС) [59], влиять тем самым на процесс взаимодействия ЛПС с ЛПС-связывающим белком (ЛСБ) и дальнейшее образование комплекса ЛСБ – ЛПС – CD14, необходимого для индукции синтеза провоспалительных цитокинов мононуклеарными клетками [60]. Еще одна из возможностей предотвратить образование комплекса ЛСБ – ЛПС – CD14 реализуется через взаимодействие ЛФ с растворимым CD14 [61]. Эти данные позволяют предположить, что одним из моноцитарных рецепторов ЛФ является CD14. Работают ли эти механизмы в условиях целого организма, пока сказать трудно.

Было выявлено, что предварительное введение ЛФ снижает ЛПС-стимулированную продукцию провоспалительных цитокинов (ФНО-α и ИЛ-6) в крови у экспериментальных животных [62], причем введение только ЛФ (без ЛПС) вызывало временное повышение уровня ИЛ-6 в крови [63]. Предложить однозначный механизм такого антиэндотоксического действия ЛФ сложно, особенно если принять во внимание сроки введения ЛФ по отношению к инъекции ЛПС. Показана эффективность только предварительного введения ЛФ, за 24 часа до ЛПС, ни более раннее (48 часов), ни более позднее (12 часов) введение не влияет на летальный исход. В такой ситуации трудно считать прямое воздействие ЛФ на связывание ЛПС с моноцитами основным фактором предотвращения септического шока, особенно если учесть фармакокинетику внутривенно введенного ЛФ. Обмен ЛФ, меченного 125I, был изучен у здоровых добровольцев [64]. После внутривенного введения он быстро покидает плазму (причем 99 % радиоизотопной метки выделяется с мочой в течение первых 24 часов), захватывается печенью и селезенкой, где происходит его катаболизм. При внутривенном введении меченого человеческого ЛФ мыши 75 % белка поглощается печенью в течение первых 15 минут [65].

В то же время было установлено, что ЛФ может активировать мышиные макрофаги через TLR4-зависимые и TLR4-независимые сигнальные пути [66]. Эта активация индуцирует экспрессию CD40 и секрецию ИЛ-6. Другое исследование in vitro продемонстрировало, что ЛФ способен индуцировать секрецию ИЛ-6 моноцитами через CD14 и TLR2, но не TLR4 [38]. При этом в экспериментах in vitroбыло продемонстрировано, что ЛФ подавляет секрецию ИЛ-6 в моноцитах посредством механизма, включающего эндоцитоз ЛФ, транслокацию его в ядро и ингибирование активации транскрипционного фактора NF-κB [67].

С противовоспалительной активностью ЛФ связывают также и его положительное действие на регенерацию костной ткани [68].

Существует немало указаний на то, что ЛФ проявляет иммуномодулирующую активность. Так, показано, что ЛФ оказывает влияние на состояние местного иммунитета, предотвращая аллерген-индуцированную миграцию дендритных клеток из эпидермиса к месту действия аллергена [69, 70].

Если говорить о влиянии ЛФ на функционирование лимфоцитов, то можно отметить, что взаимодействие ЛФ с Т-клетками (на примере клеточной линии человеческой лимфобластомы) вызывает активизацию МАРК (митоген-активированной протеинкиназы) [71], но нельзя однозначно утверждать, что ЛФ оказывает стимулирующее действие на пролиферацию лейкоцитов. В одной из последних работ сообщалось, что ЛФ стимулирует конкавалин-А-индуцированную пролиферацию мышиных спленоцитов [72], но существуют данные, подтверждающие ингибирующее влияние ЛФ на пролиферативную активность лимфоцитов [73].

Кроме модулирующего действия ЛФ на пролиферацию лимфоцитов описано влияние ЛФ на созревание Т- и В-лимфоцитов в экспериментах in vitro и поддержание баланса между Th1 и Th2 в пользу Th2 [74, 75]. В последнее время появляется все больше работ, в которых описывается важная роль ЛФ в развитии клеточного иммунитета. Это уже упоминавшееся свойство ЛФ стимулировать синтез ИЛ-18. С другой стороны, у мышей, трансгенных по человеческому ЛФ, при инфицировании их стафилококком наблюдалась Th1-поляризация иммунного ответа, стимуляция синтеза спленоцитами ФНО-α и интерферона-γ и снижение продукции ИЛ-5 и ИЛ-10 [76]. Аналогичный результат был получен при сочетанной вакцинации мышей ЛФ и БЦЖ. Показано, что ЛФ в этих условиях может выступать в качестве адъюванта, увеличивать пролиферативный ответ спленоцитов на введение прогретой вакцины БЦЖ и стимулировать продукцию ИЛ-12 (р40) с увеличением отношения ИЛ-12/ИЛ-10 [77].

Хотя большинство исследований, посвященных свойствам ЛФ, подтверждают влияние этого белка на продукцию цитокинов, механизмы такого влияния пока не ясны. Можно отметить возможный вклад ЛФ в повышение устойчивости организма к гипоксии: при превентивном внутрибрюшинном введении этого белка мышам время жизни животных увеличивалось на 40 % в условиях экспериментальной модели острой гипоксии с гиперкапнией [78]. Обнаружено, что введение апо-ЛФ вызывает синтез эритропоэтина в тканях экспериментальных животных, индуцируя транслокацию транскрипционного фактора Nrf2 в ядро, и оказывает нейропротективное действие в условиях экспериментальной ишемии мозга [79].

Важным этапом в исследованиях биологических свойств ЛФ стало доказательство, что ЛФ может влиять на процесс транскрипции генов непосредственно как транскрипционный фактор, и определение последовательности нуклеотидов специфического сайта связывания ЛФ и ДНК — 5’-GGCACTTGC-3’ [80]. До этого было установлено, что ЛФ после связывания с мембраной эукариотической клетки проходит в цитоплазму, а затем в ядро [81].

Необходимо отметить, что нуклеотидная последовательность сайта связывания ЛФ с ДНК присутствует в той части энхансера (промотора) гена ИЛ-1, которая важна для максимальной ЛПС-индуцированной активации гена этого цитокина. Не исключено, что ингибирующее действие ЛФ на ЛПС-индуцированный синтез цитокинов вызвано конкурентным связыванием ЛФ с этими участками ДНК. В то же время экспрессию гена ИЛ-1, вызванную форболмиристатацетатом, ЛФ не только не уменьшает, а, напротив, резко усиливает, сам по себе ЛФ (без дополнительной индукции) также способен вызывать экспрессию гена ИЛ-1 [82].

Дельта-ЛФ (ΔЛФ) — внутриклеточная форма ЛФ. Это эффективный транскрипционный фактор, который может связываться с промоторами генов Skp1, Bax и DcpS. По сравнению с обычной формой у этого белка отсутствует сигнальный пептид и 23 первых аминокислотных остатка. Промотор для этого белка расположен в первом интроне гена ЛФ. Посттрансляционные модификации модулируют активность этого фактора транскрипции. Более ранние исследования показали, что О-GlcN-ацилирование негативно регулирует ΔЛФ-транскрипционную активность, в то же время оно подавляет его убиквитинирование и увеличивает период его полураспада. С другой стороны, фосфорилирование активирует транскрипционную активность ΔЛФ. Показано, что в малигнизированных клетках экспрессия этого белка снижается, а высокий уровень экспрессии его транскриптов коррелирует с хорошим прогнозом при раке молочной железы [83].

Как уже подчеркивалось, ЛФ — многофункциональный белок, а его функции модулятора в иммунитете означают, что он может воздействовать на многочисленные молекулярные и клеточные мишени и, следовательно, реализовывать свои эффекты различными путями. Кроме того, предполагается, что ЛФ может оказывать противоположное действие на одну и ту же клеточную мишень.

Хотя было обнаружено несколько рецепторов ЛФ [84], до сих пор нет четких доказательств существования моноспецифического рецептора ЛФ того типа, который известен, например, для большинства цитокинов или даже для трансферрина. Лактоферриновые рецепторы обычно связывают другие лиганды. Кишечный рецептор, также известный как интелектин, является лектином [84]; рецептор на Т-лимфоцитах представляет собой нуклеолин — белок, участвующий в переносе белков в ядро [85]; третий тип рецептора гомологичен рецептору, связанному с липопротеином (lipoprotein-related receptor) [86]. Помимо взаимодействия с этими квазиспецифическими рецепторами, ЛФ может связываться с широким диапазоном клеток через в значительной степени электростатическое взаимодействие из-за его высокого pI. Три упомянутых выше квазиспецифических рецептора ЛФ обеспечивают проведение сигнала [87], а нуклеолин является хорошим кандидатом для обеспечения интернализации ЛФ в ядро с последующим воздействием на транскрипцию генов. На клеточных культурах моноцитов и фибробластов показано, что ЛФ человека активирует TLR4 через свои полисахаридные цепочки, а ЛПС-зависимую активацию TLR4 супрессирует через полипептидную часть [88].

Однако, возможно, что простое связывание ЛФ с поверхностью клетки само по себе может модулировать биологические эффекты. Многие из них требуют взаимодействия лиганд – рецептор или клетка – клетка, а присутствие ЛФ на поверхности клетки может либо усилить, либо ингибировать такие взаимодействия, что приводит к модуляции биологической активности.

Фактически в организме баланс между положительным и отрицательным контролем ЛФ, вероятно, зависит от локальной концентрации ЛФ в тканях, свободного или в комплексе с патоген-ассоциированными молекулярными паттернами, такими как ЛПС, и от иммунного статуса клеток. Все эти параметры пространственно и временно организованы, что делает фактические механизмы действия сложными для расшифровки. Это может объяснить, почему в литературе представлено множество результатов, которые указывают на кажущиеся противоречивыми эффекты ЛФ на иммунную систему, тогда как они, вероятно, не противоречат, а дополняют друг друга. В то время как эксперименты in vitro изучают отдельные части всего иммунного механизма в конкретный момент времени, эксперименты in vivo предоставляют информацию о системном, а иногда и косвенном воздействии на иммунную систему. В силу этого хорошо известна общая роль ЛФ в иммунитете, в отличие от этого мы не имеем точного представления о механизмах, через которые ЛФ реализует свое действие [89].

Стоит отметить, что, несмотря на широкую многофункциональность ЛФ и системный характер действия, проведено очень мало исследований по изучению влияния ЛФ на гормональный статус организма или возможностей модулирования его активности гормонами, не считая влияния половых гормонов на синтез ЛФ, в том числе и на стресс-индуцированные изменения гормонального и иммунного статуса, а также поведенческие реакции. Возможно, именно в этом направлении — исследовании роли ЛФ в нейроэндокриноиммунных взаимодействиях — следует искать те механизмы, которые помогут соединить противоречивые данные в целостную картину.

Среди наиболее существенных работ такого рода можно отметить исследования, демонстрирующие, что эффекты действия ЛФ, в частности по влиянию на миелопоэз, различаются для нормальных и адреналэктомированных животных [90].

Показано, что ЛФ может защищать дофаминовые нейроны от дегенерации [91].

Установлено, что ЛФ отменяет индуцированное иммобилизационным стрессом снижение антителообразующих клеток в селезенке крыс и нормализует реакции гиперчувствительности замедленного типа [92]. Кроме этого, внутрибрюшинное введение ЛФ изменяет поведенческие реакции крыс в тесте «замирания», вызванного страхом [93], а пероральное введение ЛФ крысам при постнатальном развитии улучшает их когнитивные способности в условиях стресса [94]. Включение ЛФ в диету с высоким содержанием жира способствовало снижению уровня лептина и кортикостерона в крови экспериментальных животных и повышало экспрессию группы генов гипоталамуса, ответственных за функционирование гипоталамо-гипофизарно-адреналовой системы [95].

Наши исследования показали, что превентивное введение ЛФ человека экспериментальным животным снижает стресс-стимулированное повышение экспрессии гена паттерн-распознающего рецептора TLR4 в селезенке [96], нормализует стресс-индуцированные изменения числа нейтрофильных гранулоцитов в крови и снижает стресс-индуцированное повышение концентрации кортикостерона [97]. Эти результаты были подтверждены данными японских исследователей, которые также показали, что внутрибрюшинное введение ЛФ крысам снижает стресс-индуцированное увеличение кортикостерона в крови [98].

Таким образом, можно говорить о том, что ЛФ является не только эндогенным антимикробным и хелатирующим соединением. Кроме противоинфекционной защиты ЛФ вовлечен в более широкий круг защитных механизмов, в которых он может выполнять функцию эндогенного иммуномодулятора и адаптогена.

Список сокращений

FVC — вирус лейкемии Френда; IgA — иммуноглобулин А; JNK/SAPK — Jun N-концевая киназа/стресс-активированная протеинкиназа; TLR — толл-подобный рецептор; АТФаза — аденозинтрифосфатаза; БЦЖ — сокращенное от «бацилла Кальмета – Герена» (фр. Bacillus Calmette-Guérin, BCG), вакцина против туберкулеза; ДНК — дезоксирибонуклеиновая кислота; ИЛ — интерлейкин; ЛПС — липополисахарид; ЛСБ — ЛПС-связывающий белок; ЛФ — лактоферрин; НГ — нейтрофильный гранулоцит; ФНО — фактор некроза опухолей; ΔЛФ — дельта-ЛФ.

Однобуквенное обозначение аминокислотных остатков:

А — аланин, С — цистеин, D — аспарагиновая кислота, Е — глутаминовая кислота, F — фенилаланин, G — глицин, H — гистидин, I — изолейцин, K — лизин, L — лейцин, M — метионин, N — аспарагин, P — пролин, Q — глутамин, R — аргинин, S — серин, T — треонин, V — валин, W — триптофан, Y — тирозин.

Galina M. Aleshina

Institute of Experimental Medicine

Author for correspondence.
Email: aleshina.gm@iemspb.ru
ORCID iD: 0000-0003-2886-7389

Russian Federation, Saint Petersburg

канд. биол. наук, доцент, ведущий научный сотрудник

  1. Sorensen M, Sorensen JPL. The proteins in whey. C R Trav Lab Carlsberg. 1939;23(1):55-99.
  2. Groves ML. The Isolation of a Red Protein from Milk2. J Amer Chem Soc. 1960;82(13):3345-3350. https://doi.org/10.1021/ja01498a029.
  3. Johanson B. Isolation of an iron-containing red protein from human milk. Acta Chem Scand. 1960;14(2):510-512.
  4. Masson PL, Heremans JF. Lactoferrin in milk from different species. Comp Biochem Physiol B. 1971;39(1):119-129.
  5. Masson PL. La lactoferrine. Proteine des secretions externes et des leucocyte neutrophiles. Brussel: Aracia; 1970. 232 p.
  6. Baer A, Oroz M, Blanc B. Isolation and partial characterization of ovine lactoferrin. Experientia. 1979;35(12):1554-1555. https://doi.org/10.1007/BF01953187.
  7. Oram JD, Reiter B. Inhibition of bacteria by lactoferrin and other iron-chelating agents. Biochim Biophys Acta Gen Subj. 1968;170(2):351-365. https://doi.org/10.1016/0304-4165(68)90015-9.
  8. Roberts TK, Boursnell JC. The Isolation and Characterization of Lactoferrin from Sow Milk and Boar Seminal Plasma. Reproduction. 1975;42(3):579-582. https://doi.org/10.1530/jrf.0.0420579.
  9. Jollès J, Donda A, Amiguet P, Joliès P. Mare lactotransferrin: purification, analysis and N-terminal sequence determination. FEBS Lett. 1984;176(1):185-188. https://doi.org/10.1016/0014-5793(84)80937-0.
  10. Kinkade JM, Kendall Miller WW, Segars FM. Isolation and characterization of murine lactoferrin. Biochim Biophys Acta Proteins Struct. 1976;446(2):407-418. https://doi.org/10.1016/0005-2795(76)90007-6.
  11. Берлов М.Н., Кораблева Е.С., Андреева Ю.В., и др. Лактоферрин из нейтрофилов собаки: выделение, физико-химические и антимикробные свойства // Биохимия. – 2007. – Т. 72. – № 4. – С. 551–559. [Berlov MN, Korableva ES, Andreeva YV, et al. Lactoferrin from canine neutrophils: Isolation and physicochemical and antimicrobial properties. Biokhimiia. 2007;72(4):551-559. (In Russ.)]
  12. Biserte G, Havez R, Cuvelier R. The Glycoproteins of Bronchial Secretions. Expos Annu Biochim Med. 1963;24:85-120.
  13. Masson PL, Heremans JF, Prignot JJ, Wauters G. Immunohistochemical localization and bacteriostatic properties of an iron-binding protein from bronchial mucus. Thorax. 1966;21(6):538-544.
  14. Masson PL. Lactoferrin, an Iron-Binbing Protein Ni Neutrophilic Leukocytes. J Exp Med. 1969;130(3):643-658. https://doi.org/10.1084/jem.130.3.643.
  15. Baggiolini M. Association of Lactoferrin with Specific Granules in Rabbit Heterophil Leukocytes. J Exp Med. 1970;131(3):559-570. https://doi.org/10.1084/jem.131.3.559.
  16. Bretz U. Biochemical and Morphological Characterization of Azurophil and Specific Granules of Human Neutrophilic Polymorphonuclear Leukocytes. J Cell Biol. 1974;63(1):251-269. https://doi.org/10.1083/jcb.63.1.251.
  17. Anderson BF, Baker HM, Norris GE, et al. Structure of human lactoferrin: Crystallographic structure analysis and refinement at 2·8 Å resolution. J Mol Biol. 1989;209(4):711-734. https://doi.org/10.1016/0022-2836(89)90602-5.
  18. Ward PP, Zhou X, Conneely OM. Cooperative Interactions between the Amino- and Carboxyl-terminal Lobes Contribute to the Unique Iron-binding Stability of Lactoferrin. J Biol Chem. 1996;271(22):12790-12794. https://doi.org/10.1074/jbc.271.22.12790.
  19. Baker EN, Baker HM. Molecular structure, binding properties and dynamics of lactoferrin. Cell Mol Life Sci. 2005;62(22):2531-2539. https://doi.org/10.1007/s00018-005-5368-9.
  20. Ainscough EW, Brodie AM, Plowman JE. The chromium, manganese, cobalt and copper complexes of human lactoferrin. Inorganica Chim Acta. 1979;33:149-153. https://doi.org/10.1016/s0020-1693(00)89468-2.
  21. Hansen NE, Malmquist J, Thorell J. Plasma myeloperoxidase and lactoferrin measured by radioimmunoassay: relations to neutrophil kinetics. Acta Med Scand. 1975;198(6):437-443. https://doi.org/10.1111/j.0954-6820.1975.tb19572.x.
  22. Bullen JJ, Rogers HJ, Leigh L. Iron-binding proteins in milk and resistance to Escherichia coli infection in infants. Br Med J. 1972;1(5792):69-75. https://doi.org/10.1136/bmj.1.5792.69.
  23. Weinberg ED. The Development of Awareness of Iron-withholding Defense. Perspect Biol. Med. 1993;36(2):215-221. https://doi.org/10.1353/pbm.1993.0063.
  24. Singh PK, Parsek MR, Greenberg EP, Welsh MJ. A component of innate immunity prevents bacterial biofilm development. Nature. 2002;417(6888):552-555. https://doi.org/10.1038/417552a.
  25. Bellamy W, Takase M, Wakabayashi H, et al. Antibacterial spectrum of lactoferricin B, a potent bactericidal peptide derived from the N-terminal region of bovine lactoferrin. J Appl Bacteriol. 1992;73(6):472-479. https://doi.org/10.1111/j.1365-2672.1992.tb05007.x.
  26. Wakabayashi H, Abe S, Okutomi T, et al. Cooperative Anti-CandidaEffects of Lactoferrin or Its Peptides in Combination with Azole Antifungal Agents. Microbiology and Immunology. 1996;40(11):821-825. https://doi.org/10.1111/j.1348-0421.1996.tb01147.x.
  27. van Snick JL. The Involvement of Lactoferrin in the Hyposideremia of Acute Inflammation. J Exp Med. 1974;140(4):1068-1084. https://doi.org/10.1084/jem.140.4.1068.
  28. Николаев А.А., Аншакова Н.И. Иммунохимическая и физико-химическая характеристика лактоферрина биологических жидкостей человека // Вопросы медицинской химии. – 1985. – Т. 31. – № 3. – С. 128–132. [Nikolaev AA, Anshakova NI. Immunokhimicheskaya i fiziko-khimicheskaya kharakteristika laktoferrina biologicheskikh zhidkostey cheloveka. Vopr Med Khim. 1985;45(3):128-132. (In Russ.)]
  29. Nagasawa T, Kiyosawa I, Kuwahara K. Amounts of Lactoferrin in Human Colostrum and Milk. J Dairy Sci. 1972;55(12):1651-1659. https://doi.org/10.3168/jds.S0022-0302(72)85741-2.
  30. Embleton ND, Berrington JE, McGuire W, et al. Lactoferrin: Antimicrobial activity and therapeutic potential. Semin Fetal Neonatal Med. 2013;18(3):143-149. https://doi.org/10.1016/j.siny.2013.02.001.
  31. Maacks S, Yuan H-Z, Wood WG. Development and evaluation of luminescence-based sandwich assay for plasma lactoferrin as a marker for sepsis and bacterial infections in paediatric medicine. J Biolumin Chemilumin. 1989;3(4):221-226. https://doi.org/10.1002/bio.1170030411.
  32. Ботерашвили Н.М., Алешина Г.М., Сорокина М.Н., и др. Миелопероксидаза и лактоферрин в сыворотке крови и ликворе детей больных менингитом. // Медицинская иммунология. – 2002. – Т. 4. – № 4-5. – С. 565–572. [Boterashvili NM, Aleshina GM, Sorokina MN, et al. Neutrophil Proteins in the Serum and the Cerebrospinal Fluid of Children with Meningitis. Meditsinskaia immunologiia. 2002;4(4-5):565-572. (In Russ.)]
  33. Суркова Е.А., Булгакова Т.В., Сологуб Т.С., и др. Миелопероксидаза и лактоферрин у больных муковисцедозом // Медицинская иммунология. – 2004. – Т. 6. – № 1-1. – С. 67–74. [Surkova EA, Bulgakova TV, Sologub TS, et al. Myeloperoxidase and lactoferrin from cystic fibrosis patients. Meditsinskaia immunologiia. 2004;6(1-1):67-74. (In Russ.)]
  34. Pawlica-Gosiewska D, Solnica B, Gawlik K, et al. The use of selected neutrophil protein plasma concentrations in the diagnosis of Crohn’s disease and ulcerative colitis – a preliminary report. Postepy Hig Med Dosw (Online). 2017;71(1):0-0. https://doi.org/10.5604/01.3001.0010.3810.
  35. Fillebeen C, Ruchoux M-M, Mitchell V, et al. Lactoferrin is synthesized by activated microglia in the human substantia nigra and its synthesis by the human microglial CHME cell line is upregulated by tumor necrosis factor α or 1-methyl-4-phenylpyridinium treatment. Brain Res Mol Brain Res. 2001;96(1-2):103-113. https://doi.org/10.1016/s0169-328x(01)00216-9.
  36. Valenti P, Antonini G. Lactoferrin: an important host defence against microbial and viral attack. Cell Mol Life Sci. 2005;62(22):2576-2587. https://doi.org/10.1007/s00018-005-5372-0.
  37. Puddu P, Valenti P, Gessani S. Immunomodulatory effects of lactoferrin on antigen presenting cells. Biochimie. 2009;91(1):11-18. https://doi.org/10.1016/j.biochi.2008.05.005.
  38. Puddu P, Latorre D, Carollo M, et al. Bovine lactoferrin counteracts Toll-like receptor mediated activation signals in antigen presenting cells. PLoS One. 2011;6(7):e22504. https://doi.org/10.1371/journal.pone.0022504.
  39. Saito H, Miyakawa H, Tamura Y, et al. Potent Bactericidal Activity of Bovine Lactoferrin Hydrolysate Produced by Heat Treatment at Acidic pH. J Dairy Sci. 1991;74(11):3724-3730. https://doi.org/10.3168/jds.S0022-0302(91)78563-9.
  40. Yamauchi K, Tomita M, Giehl TJ, Ellison RT, 3rd. Antibacterial activity of lactoferrin and a pepsin-derived lactoferrin peptide fragment. Infect Immun. 1993;61(2):719-728.
  41. Di Biase AM, Tinari A, Pietrantoni A, et al. Effect of bovine lactoferricin on enteropathogenic Yersinia adhesion and invasion in HEp-2 cells. J Med Microbiol. 2004;53(Pt 5):407-412. https://doi.org/10.1099/jmm.0.05410-0.
  42. Tomita M, Takase M, Wakabayashi H, Bellamy W. Antimicrobial peptides of lactoferrin. Adv Exp Med Biol. 1994;357:209-218. https://doi.org/10.1007/978-1-4615-2548-6_20.
  43. Hwang PM, Zhou N, Shan X, et al. Three-dimensional solution structure of lactoferricin B, an antimicrobial peptide derived from bovine lactoferrin. Biochemistry. 1998;37(12):4288-4298. https://doi.org/10.1021/bi972323m.
  44. Hunter HN, Demcoe AR, Jenssen H, et al. Human lactoferricin is partially folded in aqueous solution and is better stabilized in a membrane mimetic solvent. Antimicrob Agents Chemother. 2005;49(8):3387-3395. https://doi.org/10.1128/AAC.49.8.3387-3395.2005.
  45. Kuwata H, Yip TT, Tomita M, et al. Direct evidence of the generation in human stomach of an antimicrobial peptide domain (lactoferricin) from ingested lactoferrin. Biochim Biophys Acta. 1998;1429(1):129-141. https://doi.org/10.1016/s0167-4838(98)00224-6.
  46. Kuwata H, Yamauchi K, Teraguchi S, et al. Functional fragments of ingested lactoferrin are resistant to proteolytic degradation in the gastrointestinal tract of adult rats. J Nutr. 2001;131(8):2121-2127. https://doi.org/10.1093/jn/131.8.2121.
  47. Andres MT, Fierro JF. Antimicrobial mechanism of action of transferrins: selective inhibition of H+-ATPase. Antimicrob Agents Chemother. 2010;54(10):4335-4342. https://doi.org/10.1128/AAC.01620-09.
  48. Sessa R, Di Pietro M, Filardo S, et al. Effect of bovine lactoferrin on Chlamydia trachomatis infection and inflammation. Biochem Cell Biol. 2017;95(1):34-40. https://doi.org/10.1139/bcb-2016-0049.
  49. Lu L, Hangoc G, Oliff A, et al. Protective influence of lactoferrin on mice infected with the polycythemia-inducing strain of Friend virus complex. Cancer Res. 1987;47(15):4184-4188.
  50. Broxmeyer HE, Williams DE, Hangoc G, et al. The opposing actions in vivo on murine myelopoiesis of purified preparations of lactoferrin and the colony stimulating factors. Blood Cells. 1987;13(1-2):31-48.
  51. Bezault J, Bhimani R, Wiprovnick J, Furmanski P. Human lactoferrin inhibits growth of solid tumors and development of experimental metastases in mice. Cancer Res. 1994;54(9):2310-2312.
  52. Hayes TG, Falchook GF, Varadhachary GR, et al. Phase I trial of oral talactoferrin alfa in refractory solid tumors. Invest New Drugs. 2006;24(3):233-240. https://doi.org/10.1007/s10637-005-3690-6.
  53. Sakai T, Banno Y, Kato Y, et al. Pepsin-Digested Bovine Lactoferrin Induces Apoptotic Cell Death With JNK/SAPK Activation in Oral Cancer Cells. J Pharmacol Sci. 2005;98(1):41-48. https://doi.org/10.1254/jphs.FPJ04047X.
  54. Tsuda H, Sekine K, Fujita K-i, Iigo M. Cancer prevention by bovine lactoferrin and underlying mechanisms: a review of experimental and clinical studies. Biochem Cell Biol. 2002;80(1):131-136. https://doi.org/10.1139/o01-239.
  55. Gahr M, Speer CP, Damerau B, Sawatzki G. Influence of Lactoferrin on the Function of Human Polymorphonuclear Leukocytes and Monocytes. J Leukoc Biol. 1991;49(5):427-433. https://doi.org/10.1002/jlb.49.5.427.
  56. Wang W-P, Iigo M, Sato J, et al. Activation of Intestinal Mucosal Immunity in Tumor-bearing Mice by Lactoferrin. Jpn J Cancer Res. 2000;91(10):1022-1027. https://doi.org/10.1111/j.1349-7006.2000.tb00880.x.
  57. Artym J, Zimecki M, Kruzel ML. Effect of lactoferrin on the methotrexate-induced suppression of the cellular and humoral immune response in mice. Anticancer Res. 2004;24(6):3831-3836.
  58. Britigan BE, Serody JS, Cohen MS. The Role of Lactoferrin as an Anti-Inflammatory Molecule. Lactoferrin. 1994;357:143-156. https://doi.org/10.1007/978-1-4615-2548-6_14.
  59. Appelmelk BJ, An YQ, Geerts M, et al. Lactoferrin is a lipid A-binding protein. Infect Immun. 1994;62(6):2628-2632.
  60. Elass-Rochard E, Legrand D, Salmon V, et al. Lactoferrin inhibits the endotoxin interaction with CD14 by competition with the lipopolysaccharide-binding protein. Infect Immun. 1998;66(2):486-491.
  61. Baveye S, Elass E, Fernig DG, et al. Human Lactoferrin Interacts with Soluble CD14 and Inhibits Expression of Endothelial Adhesion Molecules, E-Selectin and ICAM-1, Induced by the CD14-Lipopolysaccharide Complex. Infect Immun. 2000;68(12):6519-6525. https://doi.org/10.1128/iai.68.12.6519-6525.2000.
  62. Zagulski T, Lipinski P, Zagulska A, et al. Lactoferrin can protect mice against a lethal dose of Escherichia coli in experimental infection in vivo. Br J Exp Pathol. 1989;70(6):697-704.
  63. Machnicki M, Zimecki M, Zagulski T. Lactoferrin regulates the release of tumour necrosis factor alpha and interleukin 6 in vivo. Int J Exp Pathol. 1993;74(5):433-439.
  64. Bennett RM, Kokocinski T. Lactoferrin Turnover in Man. Clin Sci (Lond). 1979;57(5):453-460. https://doi.org/10.1042/cs0570453.
  65. Retegui LA, Moguilevsky N, Castracane CF, et al. Uptake of lactoferrin by the liver. I. Role of the reticuloendothelial system as indicated by blockade experiments. Lab Invest. 1984;50(3):323-328.
  66. Curran CS, Demick KP, Mansfield JM. Lactoferrin activates macrophages via TLR4-dependent and -independent signaling pathways. Cell Immunol. 2006;242(1):23-30. https://doi.org/10.1016/j.cellimm.2006.08.006.
  67. Håversen L, Ohlsson BG, Hahn-Zoric M, et al. Lactoferrin down-regulates the LPS-induced cytokine production in monocytic cells via NF-κB. Cell Immunol. 2002;220(2):83-95. https://doi.org/10.1016/s0008-8749(03)00006-6.
  68. Yoshimaki T, Sato S, Tsunori K, et al. Bone regeneration with systemic administration of lactoferrin in non-critical-sized rat calvarial bone defects. J Oral Sci. 2013;55(4):343-348. https://doi.org/10.2334/josnusd.55.343.
  69. Kimber I, Cumberbatch M, Dearman RJ, et al. Lactoferrin and regulation of cutaneous immunity and inflammation. In: Lactoferrin: Structure, Functions and Aplications. Elsevier Science B.V.; 2000. P. 87-93.
  70. Kimber I, Cumberbatch M, Dearman RJ, et al. Lactoferrin: influences on Langerhans cells, epidermal cytokines, and cutaneous inflammation. Biochemistry and Cell Biology. 2002;80(1):103-107. https://doi.org/10.1139/o01-227.
  71. Duthille I, Masson M, Spik G, Mazurier J. Lactoferrin stimulates the mitogen-activated protein kinase in the human lymphoblastic T Jurkat cell line. Adv Exp Med Biol. 1998;443:257-260. https://doi.org/10.1007/978-1-4757-9068-9_31.
  72. Mikkelsen TL, Bakman S, Sorensen ES, et al. Sialic acid-containing milk proteins show differential immunomodulatory activities independent of sialic acid. J Agric Food Chem. 2005;53(20):7673-7680. https://doi.org/10.1021/jf050398o.
  73. Brock J. Lactoferrin: a multifunctional immunoregulatory protein? Immunol Today. 1995;16(9):417-419. https://doi.org/10.1016/0167-5699(95)80016-6.
  74. Zimecki M, Mazurier J, Spik G, Kapp JA. Human lactoferrin induces phenotypic and functional changes in murine splenic B cells. Immunology. 1995;86(1):122-127.
  75. Zimecki M, Mazurier J, Spik G, Kapp JA. Lactoferrin inhibits proliferative response and cytokine production of TH1 but not TH2 cell lines. Arch Immunol Ther Exp (Warsz). 1996;44(1):51-56.
  76. Guillen C, McInnes IB, Vaughan DM, et al. Enhanced Th1 Response to Staphylococcus aureus Infection in Human Lactoferrin-Transgenic Mice. J Immunol. 2002;168(8):3950-3957. https://doi.org/10.4049/jimmunol.168.8.3950.
  77. Hwang SA, Kruzel ML, Actor JK. Lactoferrin augments BCG vaccine efficacy to generate T helper response and subsequent protection against challenge with virulent Mycobacterium tuberculosis. Int Immunopharmacol. 2005;5(3):591-599. https://doi.org/10.1016/j.intimp.2004.11.006.
  78. Zakharova ET, Kostevich VA, Sokolov AV, Vasilyev VB. Human apo-lactoferrin as a physiological mimetic of hypoxia stabilizes hypoxia-inducible factor-1 alpha. Biometals. 2012;25(6):1247-1259. https://doi.org/10.1007/s10534-012-9586-y.
  79. Zakharova ET, Sokolov AV, Pavlichenko NN, et al. Erythropoietin and Nrf2: key factors in the neuroprotection provided by apo-lactoferrin. Biometals. 2018;31(3):425-443. https://doi.org/10.1007/s10534-018-0111-9.
  80. He J, Furmanski P. Sequence specificity and transcriptional activation in the binding of lactoferrin to DNA. Nature. 1995;373(6516):721-724. https://doi.org/10.1038/373721a0.
  81. Garre C, Bianchi-Scarra G, Sirito M, et al. Lactoferrin binding sites and nuclear localization in K562(S) cells. J Cell Physiol. 1992;153(3):477-482. https://doi.org/10.1002/jcp.1041530306.
  82. Son KN, Park J, Chung CK, et al. Human lactoferrin activates transcription of IL-1beta gene in mammalian cells. Biochem Biophys Res Commun. 2002;290(1):236-241. https://doi.org/10.1006/bbrc.2001.6181.
  83. Mariller C, Hardiville S, Hoedt E, et al. Delta-lactoferrin, an intracellular lactoferrin isoform that acts as a transcription factor. Biochem Cell Biol. 2012;90(3):307-319. https://doi.org/10.1139/o11-070.
  84. Suzuki YA, Lopez V, Lonnerdal B. Mammalian lactoferrin receptors: structure and function. Cell Mol Life Sci. 2005;62(22):2560-2575. https://doi.org/10.1007/s00018-005-5371-1.
  85. Legrand D, Vigie K, Said EA, et al. Surface nucleolin participates in both the binding and endocytosis of lactoferrin in target cells. Eur J Biochem. 2004;271(2):303-317. https://doi.org/10.1046/j.1432-1033.2003.03929.x.
  86. Meilinger M, Haumer M, Szakmary KA, et al. Removal of lactoferrin from plasma is mediated by binding to low density lipoprotein receptor-related protein/α 2-macroglobulin receptor and transport to endosomes. FEBS Lett. 1995;360(1):70-74. https://doi.org/10.1016/0014-5793(95)00082-k.
  87. Legrand D, Mazurier J. A critical review of the roles of host lactoferrin in immunity. Biometals. 2010;23(3):365-376. https://doi.org/10.1007/s10534-010-9297-1.
  88. Ken A, Keiichi H, Takafumi S, et al. TLR4-dependent regulation of intestinal immune responses by lactoferrin. (Conference proceedigs) XI International Conference on Lactoferrin Structure, Function & Applications; 2013 oct 6-10; Rome. Rome.
  89. Legrand D. Lactoferrin, a key molecule in immune and inflammatory processes. Biochem Cell Biol. 2012;90(3):252-268. https://doi.org/10.1139/o11-056.
  90. Zimecki M, Artym J, Kocieba M. Endogenous steroids are responsible for lactoferrin-induced myelopoiesis in mice. Pharmacol Rep. 2009;61(4):705-710. https://doi.org/10.1016/S1734-1140(09)70123-9.
  91. Rousseau E, Michel PP, Hirsch EC. The iron-binding protein lactoferrin protects vulnerable dopamine neurons from degeneration by preserving mitochondrial calcium homeostasis. Mol Pharmacol. 2013;84(6):888-898. https://doi.org/10.1124/mol.113.087965.
  92. Zimecki M, Artym J, Chodaczek G, et al. Effects of lactoferrin on the immune response modified by the immobilization stress. Pharmacol Rep. 2005;57(6):811-817.
  93. Kamemori N, Takeuchi T, Hayashida K, Harada E. Suppressive effects of milk-derived lactoferrin on psychological stress in adult rats. Brain Res. 2004;1029(1):34-40. https://doi.org/10.1016/j.brainres.2004.09.015.
  94. Shumake J, Barrett DW, Lane MA, Wittke AJ. Behavioral effects of bovine lactoferrin administration during postnatal development of rats. Biometals. 2014;27(5):1039-1055. https://doi.org/10.1007/s10534-014-9735-6.
  95. McManus B, Korpela R, O’Connor P, et al. Compared to casein, bovine lactoferrin reduces plasma leptin and corticosterone and affects hypothalamic gene expression without altering weight gain or fat mass in high fat diet fed C57/BL6J mice. Nutr Metab (Lond). 2015;12:53. https://doi.org/10.1186/s12986-015-0049-7.
  96. Алешина Г.М., Янкелевич И.А., Кокряков В.Н. Лактоферрин человека модулирует экспрессию гена рецептора TLR4 в селезенке крысы в условиях экспериментального стресса // Российский иммунологический журнал. – 2016. – Т. 10. – № 2. – С. 60–62. [Aleshina GM, Yankelevich IA, Kokryakov VN. Laktoferrin cheloveka moduliruet ekspressiyu gena retseptora TLR4 v selezenke krysy v usloviyakh eksperimental’nogo stressa. Ross Immunol Zhurnal. 2016;10(2):60-62. (In Russ.)]
  97. Алешина Г.М., Янкелевич И.А., Захарова Е.Т., и др. Стресс-протективное действие лактоферрина человека // Российский физиологический журнал им. И.М. Сеченова. – 2016. – Т. 102. – № 7. – С. 846–851. [Aleshina GM, Yankelevich IA, Zakharova ET, et al. Stress-protective effect of human lactoferrin. Ross Fiziol Zh Im I M Sechenova. 2016;102(7):846-851. (In Russ.)]
  98. Maekawa Y, Sugiyama A, Takeuchi T. Lactoferrin ameliorates corticosterone-related acute stress and hyperglycemia in rats. J Vet Med Sci. 2017;79(2):412-417. https://doi.org/10.1292/jvms.16-0498.

Supplementary files

Supplementary Files Action
1. Fig. 1. Ribbon diagram of human lactoferrin. The N-lobe is on the left, with its bound Fe3+ and CO32– ions (shown as spherical atoms, indicated by arrows) in the cleft between the two domains, N1 and N2. Similarly, for the C-lobe (right) the C1 and C2 domains with the Fe3+ and CO32– ions in between. The two lobes are joined by a three-turn helix [19] View (110KB) Indexing metadata

Views

Abstract - 73

PDF (Russian) - 3

Cited-By


PlumX

Refbacks

  • There are currently no refbacks.

Copyright (c) 2019 Aleshina G.M.

Creative Commons License
This work is licensed under a Creative Commons Attribution 4.0 International License.

This website uses cookies

You consent to our cookies if you continue to use our website.

About Cookies