Identification of sequences encoding for ncr-peptides and defensins in the ‘meta-assembly’ of transcriptome of pea (pisum sativum l.) Nitrogen-fixing nodules

Cover Page

Abstract


Background. The active and careless applying of antibiotics in medicine and agriculture leads to the emergence of resistance to the existing antimicrobial drugs, which reduces the effectiveness of their use. One of the ways to solve this problem is the development of new antibiotics based on plant peptides with antimicrobial activity, for example plant defensins (which identified in all plants) and NCR peptides that are specifically synthesized in nodules of some leguminous plants.

Materials and methods. In the present study, a meta-assembly of a transcriptome was constructed based on publicly available RNA-sequencing transcriptomes of pea nodules (Pisum sativum L.). This meta-assembly was used to search for sequences encoding antimicrobial peptides.

Results. As a result, 55 and 908 unique sequences encoding defensins and NCR peptides, respectively, were identified. The recognition site for the signal peptidase was predicted and sequences were divided into the signal and mature part of the peptide. Among mature defensins, 22 peptides possess in silico predicted antimicrobial activity, and for the NCR peptides family their number was 422.

Conclusion. Sequences encoding defensins and NCR peptides expressed in nitrogen-fixing pea nodules were identified. They are candidates for testing their antimicrobial activity in vitro.


ВВЕДЕНИЕ

Для сохранения урожайности сельскохозяйственных культур и защиты от негативного воздействия патогенных микроорганизмов зачастую используют препараты, включающие в свой состав антибиотики и инсектициды различной природы (вещества бактериальной, грибковой природы и их синтетические аналоги). Однако со временем многие антибиотики могут вызывать устойчивость у микроорганизмов, что существенно снижает эффективность их применения и вызывает необходимость разрабатывать новые и модернизировать старые препараты [1, 2]. Таким образом, большое значение имеет поиск уже существующих в природе молекул, обладающих антимикробной активностью.

Растения, являющиеся прикрепленными организмами, неспособны к избеганию воздействия биотических и абиотических факторов окружающей среды и вынуждены подстраиваться под них. По этой причине взаимодействие с различными симбиотическими микроорганизмами, повышающее адаптивный потенциал растительно-микробной системы, играет существенную роль в жизни растения [3].

Однако, лишь некоторые микроорганизмы могут быть полезны для растений, в то время как остальные проявляют патогенные свойства, у растений в ходе эволюции сложились многогранные и разнообразные системы защиты от микроорганизмов. Существует ряд систем, которые нацелены на управление судьбой микроорганизмов внутри растения, основной из которых является система иммунного ответа. Ее функции сводятся к распознаванию и уничтожению патогенных бактерий и грибов. Один из компонентов этой системы представляют антимикробные пептиды (АМП, или AMP — anti-microbial peptides), называемые дефензинами [4]. Дефензины — это богатые цистеином пептиды, состоящие из 45–54 аминокислот. Структурно и функционально дефензины растений, грибов и млекопитающих сходны между собой. Большинство дефензинов участвует в ингибировании грибного заражения. Некоторые представители данного семейства проявляют также антибактериальную активность и участвуют в формировании устойчивости к некоторым абиотическим факторам [5]. Дефензины и другие АМП (например, гевеинподобные пептиды и тионины) осуществляют контроль за микроорганизмами на уровне целого растения и вырабатываются во всех тканях и органах. Помимо них сложились и локальные системы, обеспечивающие ответные реакции на проникновение бактерий. Например, такая система существует в азотфиксирующих клубеньках бобовых растений, принадлежащих к кладе IRLC (inverted repeat-lacking clade), представителями которой являются люцерна слабоусеченная (Medicago truncatula Gaertn.), горох посевной (Pisum sativum L.), конские бобы (Vicia faba L.), клевер ползучий (Trifolium repens L.) и др. [6–9].

Как известно, бобовые растения обладают селективным преимуществом — способностью вступать в симбиотические взаимоотношения с почвенными бактериями, принадлежащими к группе ризобий. Бактерии проникают через корневые волоски в специальный de novo формирующийся орган — клубенек, в котором происходят процессы дифференцировки эндосимбионта — превращение бактерий в симбиотическую форму, называемую «бактероиды» [10]. В результате данного процесса бактерии преобразуют (фиксируют) атмосферный азот в форму, доступную растению-хозяину [11]. Недавно было показано, что у IRLC бобовых процессом терминальной (необратимой) дифференцировки эндосимбионта управляет семейство дефензинподобных NCR-пептидов (NCR, от англ. Nodule-specific Cysteine Rich), которые, вероятно, также являются частью иммунной системы клубенька [7]. Предполагают, что NCR-пептиды, как и дефензины, выполняют свои биологические функции в том числе за счет проявления антимикробной активности [12–16].

Дефензины и NCR-пептиды весьма вариативны по своей нуклеотидной и аминокислотной последовательности, что позволяет им подавлять жизнедеятельность широкого спектра микроорганизмов и не вызывать при этом устойчивости [17]. Ввиду все возрастающей проблемы антибиотикорезистентности самых различных бактерий, поиск и изучение данных молекул у различных растений, как модельных, так и немодельных, представляет важное и перспективное направление исследований.

Для гороха посевного, в отличие от модельного растения люцерны слабоусеченной, поиск представителей данных семейств весьма затруднен отсутствием данных геномного секвенирования. С другой стороны, существует значительное количество общедоступных баз данных транскриптомов различных органов и тканей P. sativum, в том числе клубеньков. Однако применение «готовых» транскриптомов в работе не является оптимальным, поскольку они были собраны различными способами (программами-сборщиками) с разными параметрами, вследствие чего часть информации может быть утеряна. Для получения более полной информации о транскриптах гороха посевного нами, с использованием опубликованных прочтений транскриптомов разных линий гороха, была создана метасборка транскриптома клубеньков. Эта метасборка представляет собой комбинацию раздельно собранных (с помощью одной программы-сборщика с одинаковыми параметрами) транскриптомов клубеньков гороха различных линий. Ее анализ позволяет повысить эффективность поиска целевых последовательностей по сравнению с работой на данных, сгенерированных разными рабочими группами и с использованием разных программных средств. В настоящем исследовании созданная нами метасборка была успешно применена для поиска антимикробных пептидов, относящихся к семействам дефензинов и NCR-пептидов.

МАТЕРИАЛЫ И МЕТОДЫ

На первом этапе работы поиск пептидов, обладающих антимикробной активностью, был проведен с помощью уже существующих сборок транскриптомов клубеньков гороха посевного, доступных в базе данных NCBI. Для работы использовали сборки линий Kaspa, Parafield, Cameor, SGE [18–20].

Второй этап предполагал улучшение имеющихся сборок с помощью пересборки их с применением последней, обновленной, версии программы-сборщика Trinity и объединения в метасборку.

Качество прочтений контролировали с помощью FastQC [21], удаление прочтений низкого качества и адаптеров проводили в BBduck из пакета BBmap [22]. После фильтрации данных секвенирования клубеньков гороха линии Cameor из 166 803 965 прочтений осталось 148 408 730 (89 %), для SGE из 52 021 865 — 42 054 133 (81 %), для Kaspa из 31 256 637 — 30 945 747 (99 %), для Parafield из 20 842 187 — 20 637 281 (99 %). Сборку транскриптомов из прошедших обработку прочтений осуществляли в программе Trinity (ver. 2. 8. 4) [23]. Качество сборок оценивали с помощью transRate [24] (табл. 1).

 

Таблица 1

Описание собранных в рамках работы транскриптомов клубеньков гороха

Линия гороха

Средняя длина контига

Процент транскриптов с рамками считывания

Всего контигов

SGE

932,3

65,5

48 649

Cameor

877,7

47,4

212 147

Kaspa

487,1

62,7

113 512

Parafield

484,6

61,9

91 831

 

Структурную аннотацию контигов провели с помощью Transdecoder [25]. Сборка транскриптома для количественного анализа (квантификации) и анализа однонуклеотидных полиморфизмов предполагает удаление транскриптов, не имеющих рамку считывания или имеющих рамку считывания менее 100 нуклеотидов, удаление дуплицированных транскриптов и последовательностей, перекрывающихся на 50 % и более со 100 % сходством, а также удаление всех контигов, для которых не удалось обнаружить гомологичные последовательности в доступных базах данных. Однако цель нашей работы предполагает поиск коротких антимикробных пептидов, и перечисленные выше операции могут привести к потере части целевых последовательностей, что критично в нашем случае. Именно поэтому были удалены лишь идентичные на 100 % последовательности (397 транскриптов — 0,09 % общего количества), а все контиги, содержащие рамку считывания длиннее 90 нуклеотидов, были оставлены. Таким образом, дальнейший анализ проводили на транскриптомной сборке клубеньков гороха различных линий, включающей 349 953 контига.

Поиск антимикробных пептидов в созданной de novo метасборке транскриптома клубеньков гороха выполняли с применением программы SPADA [26], которая представляет пайплайн, организующий последовательный запуск ряда других инструментов: Augustus [27], Glimmer [28], GeneWise [29], SignalP [30].

Обнаружение сигнальной последовательности в выявленных пептидах и отделение сигнального пептида от зрелой части осуществляли в программе SignalP.

Присутствие 4 или 6 цистеинов в составе зрелой части NCR-пептида валидировали с помощью множественного выравнивания в программе mafft [31] с опцией G-INS-i для более точного выравнивания.

Физико-химические свойства зрелого пептида предсказывали с применением сервиса DBAASP [32]. Результаты работы сервиса обрабатывали с помощью скрипта, написанного на языке php.

Антибактериальную активность обнаруженных пептидов предсказывали посредством веб-сервиса CAMP3 [33]. Результаты анализировали с помощью скрипта, написанного на языке программирования Python.

РЕЗУЛЬТАТЫ

Первый раунд поиска последовательностей, кодирующих NCR-пептиды, в уже полученных транскриптомных сборках клубеньков гороха посевного позволил идентифицировать de novo 553 NCR-пептида. В результате пересборки транскриптомов и повторного поиска с помощью SPADA удалось идентифицировать дополнительно 355 последовательностей, не обнаруженных в прежних сборках. Таким образом, было выявлено 908 уникальных последовательностей, кодирующих NCR-пептиды. Для 838 из них был предсказана граница между сигнальной последовательностью и зрелой частью пептида, в соответствии с чем для дальнейшего анализа была использована только предсказанная последовательность зрелого пептида.

Для зрелой части каждого из 838 NCR-пептидов методами машинного обучения были предсказаны физико-химические свойства и антибактериальная активность (табл. 2, 4).

 

Таблица 2

Предсказание антибактериальной активности зрелой части NCR-пептидов

Количество пептидов

Метод опорных векторов

Случайный лес

Дискриминантный анализ

С антибактериальной активностью

328

422

332

Без антибактериальной активности

510

416

506

 

Таблица 3

Предсказание антибактериальной активности зрелой части дефензинов

Количество пептидов

Метод опорных векторов

Случайный лес

Дискриминантный анализ

С антибактериальной активностью

15

22

16

Без антибактериальной активности

26

18

25

 

Таблица 4

Аминокислотные последовательности пяти NCR-пептидов, обладающих наибольшей предсказанной антимикробной активностью

Последовательность

Метод опорных векторов

Случайный лес

Дискриминантный анализ

QACIHDRQCRCTQHTVSKCINGFCKCYISNT

0,937

0,893

0,994

IKCDVQADCPKIPNLFPAIYKCINKKCRLIG

0,951

0,923

0,995

IVVTVDIKEIFKCESHKQCRKQMPNCKRPKIARCVSRTCKCW

0,865

0,698

0,988

KRACTYHHQCSDISCSYGYISLCIEKYCHCVKN

0,987

0,860

0,994

KKIKCRTDSDCPKQMCRFPTYNKCVIRNHCKCVLSRII

0,891

0,751

0,990

 

Таблица 5

Аминокислотные последовательности пяти дефензинов, обладающих наибольшей предсказанной антимикробной активностью

Последовательность

Метод опорных векторов

Случайный лес

Дискриминантный анализ

KVCEKRSKTWSGFCGKTRNCKKQCINVENAVFGACHRQGFFGFACFCYFKC

0,984

0,967

0,998

KTCENLSGTFKGPCIPDGNCNKHCRNNEHLLSGRCRDDFRCWCTRNC

0,826

0,945

0,902

RLCGRTSKTWRGPCYINLSCNAECTMKEQAIFGTCQHFECFC

0,664

0,851

0,816

RDCESKSHKFKGTCLSDTNCASVCQTERFTGGHCRGFRHRCYCTTHC

0,923

0,845

0,917

KFCRSKSRTWSGACIDNSPCSTECKQLEHASHGACRHNGFCFCYFNC

0,913

0,935

0,962

 

Мы также идентифицировали 55 дефензинов, 41 из которых имел сигнальную последовательность и сайт-границу между сигнальной и зрелой последовательностями. Результаты предсказания антибактериальной активности для 41 дефензина представлены в табл. 3, 5.

ОБСУЖДЕНИЕ

В процессе эволюционного развития у растительных организмов сформировался ряд уникальных механизмов, направленных на защиту от патогенов. К данным механизмам относятся как физические барьеры, так и широкий спектр синтезируемых вторичных метаболитов и антимикробных пептидов. Одним из наиболее больших семейств антимикробных пептидов являются дефензины, которые относятся к эволюционно древним последовательностям, встречающимся у большинства эукариотических организмов [5]. За исключением консервативных остатков цистеина данные пептиды демонстрируют очень низкое сходство последовательностей, с чем и связан широкий спектр активностей (противогрибковая, антибактериальная, активация при абиотических факторах), проявляемых данными пептидами [5]. Помимо дефензинов у растений выявляется также несколько семейств дефензинподобных последовательностей, часть из которых обладает более специфичным характером экспрессии и более направленной функциональностью. Так, у части бобовых растений обнаружена группа клубенек-специфичных NCR-пептидов, играющих важную роль в дифференцировке бактероидов и таким образом контролирующих развитие симбиоза [34]. Целью данного исследования была идентификация и характеристика представителей семейств дефензинов и NCR-пептидов у гороха посевного.

Оптимизация алгоритмов работы с данными, в том числе пересборка доступных транскриптомов гороха унифицированным способом с помощью обновленной версии программы Trinity с последующим их комбинированием, позволила детектировать 908 экспрессирующихся в клубеньках последовательностей, кодирующих NCR-пептиды, и 55 последовательностей, кодирующих дефензины. Для экономии времени и ресурсов перед поиском антибактериальных пептидов с помощью SPADA рекомендуют уменьшить сложность метасборки транскриптомов путем удаления дубликатов, а также транскриптов, не содержащих рамок считывания либо с рамками считывания короче 90 нуклеотидов. Однако полученный в процессе поиска набор пептидов необходимо подвергать дополнительной проверке с помощью анализа множественного выравнивания на наличие ложноположительных результатов, которые неизбежно возникают в ходе работы алгоритмов.

Роль дефензинов в развитии растительно-микробных симбиотических взаимоотношений изучена слабо. Лишь в нескольких исследованиях было показано участие дефензинов в симбиозе. Сравнительный транскриптомный анализ корней и клубеньков, образуемых в ходе развития актиноризного симбиоза растением Datisca glomerata и представителями рода Frankia, позволил выявить отдельную группу дефензинов, специфично экспрессирующихся в клубеньках и отличающихся от других дефензинов наличием особого терминального домена [35]. Клубенек-специфичная экспрессия ряда генов, кодирующих дефензины, была продемонстрирована и в исследованиях M. truncatula [34]. Активация экспрессии ряда генов, кодирующих дефензинподобные пептиды, была выявлена и при взаимодействии лядвенца японского (Lotus japonicus (Regel.) K. Larsen) с грибом арбускулярной микоризы Rhizophagus irregularis [36]. Однако конкретная роль обнаруженных пептидов в развитии данных симбиозов остается неизвестной.

Несмотря на сходство с дефензинами — наличие консервативного цистеинового паттерна, высокой вариабельности последовательностей, возможности проявления антимикробной активности, что, вероятно, объясняется родством этих двух генных семейств, основной функцией NCR-пептидов является дифференцировка свободноживущей бактерии в азотфиксирующий бактероид в пределах симбиотического компартмента [37–39]. Известно, что NCR-пептиды, особенно обладающие высоким положительным зарядом, могут взаимодействовать с электроотрицательной бактериальной мембраной, обусловливая формирование пор на поверхности бактериальной клетки. В случае сильного воздействия такого рода пептидов данный процесс может привести к лизису бактериальной клетки [16]. Однако в случае симбионтов формирование пор носит временный характер, и, по-видимому, поры необходимы для проникновения других NCR-пептидов, которые взаимодействуют с внутриклеточными мишенями, изменяя физиологию и морфологию клетки [15, 40]. Предполагают, что важным условием является наличие белка BacA на бактериальной мембране, которой также способствует импорту NCR-пептидов внутрь клетки, где они могут обезвреживаться бактериальной системой деградации белков [41, 42].

В данном исследовании найдено 908 уникальных последовательностей, кодирующих NCR-пептиды, у P. sativum. Стоит отметить, что для люцерны слабоусеченной на данный момент описано более 700 представителей данного семейства, что неудивительно, поскольку геном гороха превосходит по размеру геном люцерны почти в десять раз. С другой стороны, среди найденных в данной работе последовательностей пептидов у гороха вследствие несовершенства алгоритмов сборки могут присутствовать химерные последовательности; кроме того, некоторые обнаруженные последовательности могут представлять собой аллельные состояния одного и того же AMP-кодирующего гена. Однозначно разрешить проблему химерных последовательностей возможно лишь после проведения полногеномного секвенирования. Проблема аллельных вариантов может быть решена посредством секвенирования транскриптома каждой из изучаемых линий гороха и оценки покрытия прочтениями каждого пептида. Таким образом, для верификации обнаруженных пептидов следует применять методы секвенирования следующего поколения, что будет являться предметом дальнейших исследований.

Среди дефензинов и NCR-пептидов обнаружены представители с предсказанной антимикробной активностью. При этом среди NCR-пептидов найдено большее количество последовательностей с высокой степенью вероятности проявления антимикробной активности по сравнению с идентифицированными дефензинами, что отражает их большую представленность в транскриптомных данных. Такое разнообразие NCR-пептидов по составу и, соответственно, возможности и степени проявления антимикробной активности в клетках клубенька может свидетельствовать о том, что NCR-пептиды внутри клубенька функционально замещают дефензины и образуют локальную иммунную систему растения, которая элиминирует нежелательные бактерии и в то же время способствует дифференцировке симбиотических партнеров.

ЗАКЛЮЧЕНИЕ

Выявление и характеристика дефензинов и дефензинподобных пептидов важна не только для понимания их роли в защитных реакциях растений, но и для обнаружения новых антимикробных соединений. Данное направление исследований весьма актуально, поскольку патогенные бактерии сельскохозяйственных растений наносят значительный экономический ущерб и влияют на продовольственную безопасность [43]. Интерес к дефензинам продиктован, таким образом, возможностью создания на их основе новых типов защитных агентов. При этом, поскольку антимикробные пептиды могут сильно варьировать у различных видов растений, важной задачей представляется идентификация АМП у большого числа видов, в том числе и относящихся к сельскохозяйственно ценным культурам. При этом бобовые растения представляют собой интересный объект для изучения АМП, поскольку у них обнаружены не только дефензины, но и уникальные для бобовых дефензинподобные NCR-пептиды. Поскольку дефензины и NCR-пептиды весьма многочисленны и вариабельны по своему составу, атакуют различные мишени в клетках патогенных микроорганизмов и при этом вырабатываются совместно, микроорганизмам не удается противостоять такому коктейлю из АМП и приобретать к ним устойчивость. Идентифицированные АМП с широким спектром действия могут найти применение не только в области противодействия патогенам растений, но и в отношении патогенов животных и человека.

Характеристика природных антимикробных молекул весьма важное и перспективное направление исследований. Как видно на примере белковых семейств, изученных в данной работе, поиск и описание данных молекул вносит существенный вклад в понимание процессов взаимоотношения растений и бактерий, а также позволяет раскрыть механизмы, лежащие в основе различных реакций на взаимодействие с патогенными и полезными бактериями. Понимание характеристик, лежащих в основе их антимикробной активности, позволит конструировать/модернизировать имеющиеся пептиды, которые можно использовать в качестве антибиотиков нового поколения, а также управлять эффективностью азотфиксирующего симбиоза.

Благодарности

Работа по выявлению антимикробных последовательностей, принадлежащих к семейству NCR-пептидов, была поддержана Российским фондом фундаментальных исследований (грант № 18-34-00187 мол_а). Работа по анализу последовательностей, кодирующих дефензины, была проведена за счет средств Государственного задания Минобрнауки (№ 0664-2019-0022-С-01) за 2019 г.

Evgeny A. Zorin

Federal State Budget Scientific Institution “All-Russia Research Institute for  Agricultural Microbiology”

Author for correspondence.
Email: kjokkjok8@gmail.com

Russian Federation, Saint-Petersburg, Podbelsky chausse, 3.

engineer-researcher, Laboratory of Genetics of Plant-microbe Interactions

Marina S. Kliukova

Federal State Budget Scientific Institution “All-Russia Research Institute for Agricultural Microbiology”

Email: marina.kliukova@gmail.com

Russian Federation, Saint-Petersburg, Podbelsky chausse, 3.

engineer-researcher, Laboratory of Genetics of Plant-microbe Interactions

Olga A. Kulaeva

Federal State Budget Scientific Institution “All-Russia Research Institute for Agricultural Microbiology”

Email: okulaeva@arriam.ru

Russian Federation, Saint-Petersburg, Podbelsky chausse, 3.

Phd, Laboratory of Genetics of Plant-microbe Interactions

Alexey M. Afonin

Federal State Budget Scientific Institution “All-Russia Research Institute for Agricultural Microbiology”

Email: afoninalexeym@gmail.com

Russian Federation, Saint-Petersburg, Podbelsky chausse, 3.

engineer-researcher, Laboratory of Genetics of Plant-microbe Interactions

Igor A. Tikhonovich

Federal State Budget Scientific Institution “All-Russia Research Institute for Agricultural Microbiology”; Federal State Budget Educational institution of higher education "Saint Petersburg state University"

Email: arriam2008@yandex.ru

Russian Federation, Saint-Petersburg, Podbelsky chausse, 3.

PI, academician of RAS, Sc. D., professor

Vladimir A. Zhukov

Federal State Budget Scientific Institution “All-Russia Research Institute for Agricultural Microbiology”

Email: vzhukov@arriam.ru

Russian Federation, Saint-Petersburg, Podbelsky chausse, 3

Phd, head of laboratory, Laboratory of Genetics of Plant-microbe Interactions

  1. Aslam B, Wang W, Arshad MI, et al. Antibiotic resistance: a rundown of a global crisis. Infect Drug Resist. 2018;11: 1645-58. https://doi.org/10. 2147/IDR.S173867.
  2. Ventola CL. The antibiotic resistance crisis: part 1: causes and threats. PT. 2015;40(4):277-283.
  3. Тихонович И.А., Андронов Е.Е., Борисов А.Ю., и др. Принцип дополнительности геномов в расширении адаптационного потенциала растений // Генетика. – 2015. – Т. 51. – № 9. – С. 973–990. [Tikhonovich IA, Andronov EE, Borisov AY, et al. The principle of genome complementarity in the enhancement of plant adaptive capacities. Russian Journal of Genetics. 2015;51(9):831-846. (In Russ.)]. https://doi.org/10. 7868/S001667581509012X.
  4. Nawrot R, Barylski J, Nowicki G, et al. Plant antimicrobial peptides. Folia Microbiol (Praha). 2014;59(3): 181-196. https://doi.org/10. 1007/s12223-013-0280-4.
  5. Parisi K, Shafee TMA, Quimbar P, et al. The evolution, function and mechanisms of action for plant defensins. Semin Cell Dev Biol. 2019;88:107-118. https://doi.org/10. 1016/j.semcdb.2018. 02. 004.
  6. Kato T, Kawashima K, Miwa M, et al. Expression of genes encoding late nodulins characterized by a putative signal peptide and conserved cysteine residues is reduced in ineffective pea nodules. Mol Plant Microbe Interact. 2002;15(2):129-137. https://doi.org/10. 1094/MPMI.2002. 15. 2. 129.
  7. Mergaert P, Nikovics K, Kelemen Z, et al. A novel family in Medicago truncatula consisting of more than 300 nodule-specific genes coding for small, secreted polypeptides with conserved cysteine motifs. Plant Physiol. 2003;132(1):161-173. https://doi.org/10. 1104/pp.102. 018192.
  8. Frühling M, Albus U, Hohnjec N, et al. A small gene family of broad bean codes for late nodulins containing conserved cysteine clusters. Plant Sci. 2000;152(1):67-77. https://doi.org/10. 1016/s0168-9452(99)00219-8.
  9. Crockard A, Bjourson J, Dazzo B, Cooper JE. A white clover nodulin gene, dd23b, encoding a cysteine cluster protein, is expressed in roots during the very early stages of interaction with Rhizobium leguminosarumbiovar trifolii and after treatment with chitolipooligosaccharide Nod factors. J Plant Res. 2002;115(6):439-447. https://doi.org/10. 1007/s10265-002-0053-7.
  10. Yeragani VK, Pohl R, Balon R. Lactate-induced panic and beta-adrenergic blockade. Psychiatry Res. 1990;32(1): 93-94. https://doi.org/10. 1016/0165-1781(90)90139-v.
  11. Mylona P, Pawlowski K, Bisseling T. Symbiotic nitrogen fixation. Plant Cell. 1995;7(7):869-885. https://doi.org/10. 1105/tpc.7. 7. 869.
  12. Arnold MF, Shabab M, Penterman J, et al. Genome-wide sensitivity analysis of the microsymbiont Sinorhizobium meliloti to symbiotically important, defensin-like host peptides. MBio. 2017;8(4).pii: e01060-17. https://doi.org/10. 1128/mBio.01060-17.
  13. Nagy K, Mikuláss KR, Végh AG, et al. Interaction of cysteine-rich cationic antimicrobial peptides with intact bacteria and model membranes. Gen Physiol Biophys. 2015;34(2):135-144. https://doi.org/10. 4149/gpb_2015002.
  14. Ordögh L, Vörös A, Nagy I, et al. Symbiotic plant peptides eliminate Candida albicans both in vitro and in an epithelial infection model and inhibit the proliferation of immortalized human cells. Biomed Res Int. 2014;2014:320796. https://doi.org/10. 1155/2014/320796.
  15. Farkas A, Maróti G, Durgő H, et al. Medicago truncatula symbiotic peptide NCR247 contributes to bacteroid differentiation through multiple mechanisms. Proc Natl Acad Sci USA. 2014;111(14):5183-5188. https://doi.org/10. 1073/pnas.1404169111.
  16. Farkas A, Maróti G, Kereszt A, et al. Comparative analysis of the bacterial membrane disruption effect of two natural plant antimicrobial peptides. Front Microbiol. 2017;8:51. https://doi.org/10. 3389/fmicb.2017. 00051.
  17. Van der Weerden NL, Anderson MA. Plant defensins: common fold, multiple functions. Fungal Biol Rev. 2013;26(4):121-131. https://doi.org/10. 1016/j.fbr.2012. 08. 004.
  18. Sudheesh S, Sawbridge TI, Cogan NO, et al. De novo assembly and characterisation of the field pea transcriptome using RNA-Seq. BMC Genomics. 2015;16(1):611. https://doi.org/10. 1186/s12864-015-1815-7.
  19. Alves-Carvalho S, Aubert G, Carrère S, et al. Full-length de novoassembly of RNA-seq data in pea (Pisum sativum L.) provides a gene expression atlas and gives insights into root nodulation in this species. Plant J. 2015;84(1):1-19. https://doi.org/10. 1111/tpj.12967.
  20. Zhukov VA, Zhernakov AI, Kulaeva OA, et al. De novo assembly of the pea (Pisum sativum L.) nodule transcriptome. Int J Genomics. 2015;2015:1-11. https://doi.org/10. 1155/2015/695947.
  21. Babraham Bioinformatics. FastQC [Internet]. Available from: https://www.bioinformatics.babraham.ac.uk/projects/fastqc/.
  22. Joint Genome Institute. BBTools [Internet]. Available from: https://jgi.doe.gov/data-and-tools/bbtools/.
  23. Grabherr MG, Haas BJ, Yassour M, et al. Trinity: reconstructing a full-length transcriptome without a genome from RNA-Seq data. Nat Biotechnol. 2011;29(7):644-652. https://doi.org/10. 1038/nbt.1883.
  24. Smith-Unna R, Boursnell C, Patro R, et al. TransRate: reference-free quality assessment of de novo transcriptome assemblies. Genome Res. 2016;26(8):1134-1144. https://doi.org/10. 1101/gr.196469. 115.
  25. Haas BJ, Papanicolaou A, Yassour M, et al. De novo transcript sequence reconstruction from RNA-seq using the Trinity platform for reference generation and analysis. Nat Protoc. 2013;8(8):1494-1512. https://doi.org/10. 1038/nprot.2013. 084.
  26. Zhou P, Silverstein KA, Gao L, et al. Detecting small plant peptides using SPADA (small peptide alignment discovery application). BMC Bioinformatics. 2013;14(1):335. https://doi.org/10. 1186/1471-2105-14-335.
  27. Stanke M, Morgenstern B. AUGUSTUS: a web server for gene prediction in eukaryotes that allows user-defined constraints. Nucleic Acids Res. 2005;33:W465-W467. https://doi.org/10. 1093/nar/gki458.
  28. Delcher AL, Bratke KA, Powers EC, Salzberg SL. Identifying bacterial genes and endosymbiont DNA with Glimmer. Bioinformatics. 2007;23(6):673-679. https://doi.org/10. 1093/bioinformatics/btm009.
  29. Birney E, Clamp M, Durbin R. GeneWise and genomewise. Genome Res. 2004;14(5):988-995. https://doi.org/10. 1101/gr.1865504.
  30. Armenteros JJ, Tsirigos KD, Sønderby CK, et al. SignalP 5. 0 improves signal peptide predictions using deep neural networks. Nat Biotechnol. 2019;37(4):420-423. https://doi.org/10. 1038/s41587-019-0036-z.
  31. Katoh K, Misawa K, Kuma K, Miyata T. MAFFT: a novel method for rapid multiple sequence alignment based on fast Fourier transform. Nucleic Acids Res. 2002;30(14):3059-3066. https://doi.org/10. 1093/nar/gkf436.
  32. Pirtskhalava M, Gabrielian A, Cruz P, et al. DBAASP v.2: an enhanced database of structure and antimicrobial/cytotoxic activity of natural and synthetic peptides. Nucleic Acids Res. 2016;44(D1):D1104-1112. https://doi.org/10. 1093/nar/gkv1174.
  33. Waghu FH, Barai RS, Gurung P, Idicula-Thomas S. CAMPR3: a database on sequences, structures and signatures of antimicrobial peptides. Nucleic Acids Res. 2016;44(D1): D1094-1097. https://doi.org/10. 1093/nar/gkv1051.
  34. Maróti G, Downie JA, Kondorosi É. Plant cysteine-rich peptides that inhibit pathogen growth and control rhizobial differentiation in legume nodules. Curr Opin Plant Biol. 2015;26:57-63. https://doi.org/10. 1016/j.pbi.2015. 05. 031.
  35. Demina IV, Persson T, Santos P, et al. Comparison of the nodule vs. root transcriptome of the actinorhizal plant Datisca glomerata: actinorhizal nodules contain a specific class of defensins. PLoS ONE. 2013;8(8):e72442. https://doi.org/10. 1371/journal.pone.0072442.
  36. Handa Y, Nishide H, Takeda N, et al. RNA-seq Transcriptional profiling of an arbuscular mycorrhiza provides insights into regulated and coordinated gene expression in Lotus japonicus and Rhizophagus irregularis. Plant Cell Physiol. 2015;56(8):1490-1511. https://doi.org/10. 1093/pcp/pcv071.
  37. Silverstein KA, Graham MA, VandenBosch KA. Novel paralogous gene families with potential function in legume nodules and seeds. Curr Opin Plant Biol. 2006;9(2): 142-6. https://doi.org/10. 1016/j.pbi.2006. 01. 002.
  38. Mergaert P, Uchiumi T, Alunni B, et al. Eukaryotic control on bacterial cell cycle and differentiation in the Rhizobium-legume symbiosis. Proc Natl Acad Sci USA. 2006;103(13):5230-5235. https://doi.org/10. 1073/pnas.0600912103.
  39. Van de Velde W, Zehirov G, Szatmari A, et al. Plant peptides govern terminal differentiation of bacteria in symbiosis. Science. 2010;327(5969):1122-1126. https://doi.org/10. 1126/science.1184057.
  40. Maróti G, Kondorosi É. Nitrogen-fixing Rhizobium-legume symbiosis: are polyploidy and host peptide-governed symbiont differentiation general principles of endosymbiosis? Front Microbiol. 2014;5:326. https://doi.org/10. 3389/fmicb.2014. 00326.
  41. Haag AF, Baloban M, Sani M, et al. Protection of sinorhizobium against host cysteine-rich antimicrobial peptides is critical for symbiosis. PLOS Biol. 2011;9(10):e1001169. https://doi.org/10. 1371/journal.pbio.1001169.
  42. Meadows R. How symbiotic bacteria survive host defenses. PLoS Biol. 2011;9(10):e1001164. https://doi.org/10. 1371/journal.pbio.1001164.
  43. Mansfield J, Genin S, Magori S, et al. Top 10 plant pathogenic bacteria in molecular plant pathology. Mol Plant Pathol. 2012;13(6):614-629. https://doi.org/10. 1111/j.1364-3703. 2012. 00804. x.

Supplementary files

There are no supplementary files to display.

Views

Abstract - 44

PDF (Russian) - 31

Cited-By


PlumX


Copyright (c) 2019 Zorin E.A., Kliukova M.S., Kulaeva O.A., Afonin A.M., Tikhonovich I.A., Zhukov V.A.

Creative Commons License
This work is licensed under a Creative Commons Attribution 4.0 International License.

This website uses cookies

You consent to our cookies if you continue to use our website.

About Cookies